PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cc07_g09610
Common NameGSCOC_T00037219001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Rubiaceae; Ixoroideae; Coffeeae; Coffea
Family ZF-HD
Protein Properties Length: 357aa    MW: 39042.3 Da    PI: 9.1735
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cc07_g09610genomeCGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer105.82.5e-33126180358
  ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreve 58 
                  +vrY+eClkNhAas+Ggh vDGCgEfmps geegt++al+CaAC+CHRnFHR+e +
  Cc07_g09610 126 SVRYRECLKNHAASMGGHIVDGCGEFMPS-GEEGTPEALRCAACDCHRNFHRKEGD 180
                  79**************************9.999********************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-23126180IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047702.4E-31127178IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.5E-31128178IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.647129178IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.602.9E-29285354IPR009057Homeodomain-like
SuperFamilySSF466896.98E-19289353IPR009057Homeodomain-like
PROSITE profilePS500718.73290354IPR001356Homeobox domain
TIGRFAMsTIGR015657.6E-28292349IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 357 aa     Download sequence    Send to blast
MEPRGQEKDI GSLPYSVGYS PPSFTNESST KPPSAPSLDR RRIDAGRGSI IPITPSPNQT  60
LDQQQNPPQQ QLYAHKDSNP DPDPVQVTNA TPISGASNSK TATVAAQQPP PAPAASGANT  120
TAPGSSVRYR ECLKNHAASM GGHIVDGCGE FMPSGEEGTP EALRCAACDC HRNFHRKEGD  180
GEPQAGTSGY YTQNHTPRLH NSAHQATLFR TQPQTSPIRM PPQHHHHQQQ HKFAHSYSHG  240
LTASPTGPMA PIMMTFGGNS GGAAAESSSE DLNMFQYNAG GQVVQQAFSV SRKRFRTKFT  300
QQQKDRMNEF AEKLGWKIQK QDEQEVQQFC SEVGVKRQVF KVWMHNNKQA MKKKQM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A9e-232933481873ZF-HD homeobox family protein
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00268DAPTransfer from AT2G18350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099626.11e-114PREDICTED: zinc-finger homeodomain protein 6
TrEMBLA0A068U3220.0A0A068U322_COFCA; Uncharacterized protein
STRINGPOPTR_0005s12420.18e-99(Populus trichocarpa)
STRINGPOPTR_0007s12970.15e-99(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75240.11e-61homeobox protein 33